Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ADIPOQ (Human) Recombinant ProteinBioActive

  • Catalog # : P5936
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human ADIPOQ (Q15848, 19 a.a. - 244 a.a.) partial recombinant protein with His tag expressed in Hi-5 cells.
  • Sequence:
  • RGHHHHHHHHETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN
  • Host:
  • Insect
  • Theoretical MW (kDa):
  • 35.0
  • Reactivity:
  • Human, Mouse
  • Form:
  • Lyophilized
  • Preparation Method:
  • Insect cell (Hi-5) expression system
  • Purity:
  • 97%
  • Endotoxin Level:
  • Endotoxin level is < 0.1 ng/ug of protein (< 1 EU/ug).
  • Activity:
  • Determined by a cytotoxic assay using M1 cells. The ED50 for this effect is 3.0-6.0 ug/ml.
  • Recommend Usage:
  • Activity assay
    SDS-PAGE
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • Lyophilized from solutions contain no sodiun azide nor carrier protein
  • Storage Instruction:
  • Store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 9370
  • Gene Name:
  • ADIPOQ
  • Gene Alias:
  • ACDC,ACRP30,ADPN,APM-1,APM1,GBP28,adiponectin
  • Gene Description:
  • adiponectin, C1Q and collagen domain containing
  • Gene Summary:
  • This gene is expressed in adipose tissue exclusively. It encodes a protein with similarity to collagens X and VIII and complement factor C1q. The encoded protein circulates in the plasma and is involved with metabolic and hormonal processes. [provided by RefSeq
  • Other Designations:
  • adipocyte, C1Q and collagen domain containing,adipocyte, C1Q and collagen domain-containing,adiponectin,adipose most abundant gene transcript 1,gelatin-binding protein 28
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook