Product Browser

Last updated: 2017/12/10

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IFNA2 (Human) Recombinant ProteinBioActive

  • Catalog # : P5916
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human IFNA2 (P01563, 171 a.a.) full-length recombinant protein with C-terminal His tag expressed in Nicotiana benthamiana.
  • Sequence:
  • CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKEHHHHHH
  • Host:
  • Plants
  • Theoretical MW (kDa):
  • 20.1
  • Reactivity:
  • Human
  • Form:
  • Lyophilized
  • Preparation Method:
  • Non-transgenic plants (Nicotiana benthamiana) expression system
  • Purification:
  • Sequential chromatography (FPLC)
  • Purity:
  • > 97% by SDS-PAGE
  • Endotoxin Level:
  • < 0.04 EU/ug protein
  • Activity:
  • The specific activity was determined by a quantitative gene reported bioassay using human Type I interferon-sensitive. The activity is < 8 x 108 units/mg in reference to a viral resistance assay using bovine kidney MDBK cells.
  • Quality Control Testing:
  • 0.3 ug/lane in 15% SDS-polyacrylamide gel and stained with Coomassie blue

    QC Testing of P5916
  • Storage Buffer:
  • Lyophilized from Tris HCl 0.05M buffer at pH 7.4 and 0.01% SDS
  • Storage Instruction:
  • Store at -20°C on dry atmosphere.
    After reconstitution with sterilized water, store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Recombinant protein)
  • Western Blot (Recombinant protein)
  • Western blot analysis of IFNA2 (Human) Recombinant Protein (Cat # P5916) using protein specific antibody.
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Western Blot (Recombinant protein)
  • Western Blot (Recombinant protein)
  • enlarge
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 3440
  • Gene Name:
  • IFNA2
  • Gene Alias:
  • IFNA,INFA2,MGC125764,MGC125765
  • Gene Description:
  • interferon, alpha 2
  • Other Designations:
  • OTTHUMP00000021143,alpha-2a interferon,interferon alpha 2b,interferon alpha A
  • RSS
  • YouTube
  • Linkedin
  • Facebook