Product Browser

Last updated: 2017/1/15

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IL3 (Human) Recombinant ProteinBioActive

  • Catalog # : P5913
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human IL3 (P08700, 20 a.a. - 152 a.a.) full-length recombinant protein with N-terminal His tag expressed in Nicotiana benthamiana.
  • Sequence:
  • HHHHHHHHAPMTQTTSLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
  • Host:
  • Plants
  • Theoretical MW (kDa):
  • 18-22
  • Reactivity:
  • Human
  • Form:
  • Lyophilized
  • Preparation Method:
  • Non-transgenic plants (Nicotiana benthamiana) expression system
  • Purification:
  • Sequential chromatography (FPLC)
  • Purity:
  • > 97% by SDS-PAGE
  • Endotoxin Level:
  • < 0.04 EU/ug protein
  • Activity:
  • The activity is determined by the dose-dependent stimulation of TF-1 cells. ED50 is typically less than 1 ng/ml.
  • Quality Control Testing:
  • 0.3 ug/lane in 15% SDS-polyacrylamide gel and stained with Coomassie blue

    QC Testing of P5913
    It has a predicted molecular mass of 16.2 KDa, however as result of glycosylation, the recombinant protein could migrate with an apparent molecular mass of 18-22 kDa in SDSPAGE.
  • Storage Buffer:
  • Lyophilized from PBS 1X buffer pH 7.4.
  • Storage Instruction:
  • Store at -20°C on dry atmosphere.
    After reconstitution with sterilized water, store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Recombinant protein)
  • Western Blot (Recombinant protein)
  • Western blot analysis of IL3 (Human) Recombinant Protein (Cat # P5913) using protein specific antibody. Lane 1: 0.15 ug and lane 2: 0.3 ug of IL3 (Human) Recombinant Protein
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Western Blot (Recombinant protein)
  • Western Blot (Recombinant protein)
  • enlarge
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 3562
  • Gene Name:
  • IL3
  • Gene Alias:
  • IL-3,MCGF,MGC79398,MGC79399,MULTI-CSF
  • Gene Description:
  • interleukin 3 (colony-stimulating factor, multiple)
  • Gene Summary:
  • The protein encoded by this gene is a potent growth promoting cytokine. This cytokine is capable of supporting the proliferation of a broad range of hematopoietic cell types. It is involved in a variety of cell activities such as cell growth, differentiation and apoptosis. This cytokine has been shown to also possess neurotrophic activity, and it may be associated with neurologic disorders. [provided by RefSeq
  • Other Designations:
  • P-cell stimulating factor,hematopoietic growth factor,interleukin 3,mast-cell growth factor,multilineage-colony-stimulating factor
  • RSS
  • YouTube
  • Linkedin
  • Facebook