Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

FAM3D (Human) Recombinant Protein

  • Catalog # : P5907
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human FAM3D (NP_620160, 26 a.a. - 224 a.a.) partial recombinant protein with C-terminal hexahistidine tag expressed in HEK293EBNA1 cells.
  • Sequence:
  • GSYMSFSMKTIRLPRWLAASPTKEIQVKKYKCGLIKPCPANYFAFKICSGAANVVGPTMCFEDRMIMSPVKNNVGRGLNIALVNGTTGAVLGQKAFDMYSGDVMHLVKKEIPGGALVLVASYDDPGTKMNDESRKLFSDLGSSYAKQLGFRDSWVGAKDLRGKSPFEQKNSPDTNKYEGWPELLEMEGCMPPKPFAAAHHHHHH
  • Host:
  • Human
  • Theoretical MW (kDa):
  • 23.1
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Preparation Method:
  • Mammalian cell (HEK293EBNA1) expression system
  • Quality Control Testing:
  • NuPAGE Stained with Coomassie Blue

    QC Testing of P5907
  • Storage Buffer:
  • In 25 mM Tris, 150 mM NaCl, pH 7.5 without preservative.
  • Storage Instruction:
  • Store at -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • FAM3D
  • Gene Alias:
  • EF7,OIT1
  • Gene Description:
  • family with sequence similarity 3, member D
  • Other Designations:
  • cytokine-like protein EF-7
  • RSS
  • YouTube
  • Linkedin
  • Facebook