Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

fshb/cga (Zebra fish) Recombinant Protein

  • Catalog # : P5905
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Zebra fish fshb/cga (NP_991187, 17 a.a. - 130 a.a.) and (NP_991250, 24 a.a. - 117 a.a.) partial recombinant protein with N-terminal Strep tag expressed in HEK293EBNA1 cells.
  • Sequence:
  • GSWSHPQFEKGSWSHPQFEKGSWSHPQFEKGSAESECRCSCRLTNISITVESEECGSCVTIDTTACAGLCWTMDRVYPSSMAQHTQKVCNFKNLMYKSYEFKGCPAGVDSVFVYPVALSCECNQVNSDTTDWGAISPQTTSCSIHGGGSGGGSGGGSGGGYSRNDVSNYGCEECKLKMNERFSKPGAPVYQCVGCCFSRAYPTPLRSKKTMLVPKNITSEATCCVAKESKMVATNIPLYNHTDCHCSTCYYHKS
  • Host:
  • Human
  • Theoretical MW (kDa):
  • 27.9
  • Reactivity:
  • Zebra fish
  • Form:
  • Liquid
  • Preparation Method:
  • Mammalian cell (HEK293EBNA1) expression system
  • Concentration:
  • 0.98 mg/mL
  • Quality Control Testing:
  • NuPAGE Stained with Coomassie Blue

    QC Testing of P5905
  • Storage Buffer:
  • In PBS without preservative
  • Storage Instruction:
  • Store at -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Protein Accession#:
  • NP_991187 (Gene ID : 402919);NP_991250 (Gene ID : 402987)
  • Gene Name:
  • fshb
  • Gene Alias:
  • gthI
  • Gene Description:
  • follicle stimulating hormone, beta polypeptide
  • Other Designations:
  • FSH Beta,Gth I,follicle-stimulating hormone beta subunit
  • Gene Information
  • Protein Accession#:
  • NP_991187 (Gene ID : 402919);NP_991250 (Gene ID : 402987)
  • Gene Name:
  • cga
  • Gene Alias:
  • GPHa,GTH-alpha,gsu-alpha
  • Gene Description:
  • glycoprotein hormones, alpha polypeptide
  • Other Designations:
  • gonadotropin alpha subunit
  • RSS
  • YouTube
  • Linkedin
  • Facebook