Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MBL2 (Human) Recombinant Protein

  • Catalog # : P5889
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human MBL2 (NP_000233, 21a.a. - 248 a.a.) partial recombinant protein with N-terminal hexahistidine tag and a TEV cleavage site expressed in HEK293EBNA1 cells.
  • Sequence:
  • GSHHHHHHDYDIPSSENLYFQGSETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSHLAVCEFPIAAA
  • Host:
  • Human
  • Reactivity:
  • Human
  • Form:
  • Liquid
  • Preparation Method:
  • Mammalian cell (HEK293EBNA1) expression system
  • Concentration:
  • 175 ug/mL
  • Quality Control Testing:
  • NuPAGE Stained with Coomassie Blue

    QC Testing of P5889
    Lane1: Non-reduced MBL2, Lane2: Reduced MBL2
  • Storage Buffer:
  • In PBS without preservative
  • Storage Instruction:
  • Store at -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 4153
  • Gene Name:
  • MBL2
  • Gene Alias:
  • COLEC1,HSMBPC,MBL,MBP,MBP1,MGC116832,MGC116833
  • Gene Description:
  • mannose-binding lectin (protein C) 2, soluble (opsonic defect)
  • Gene Summary:
  • This gene encodes the soluble mannose-binding lectin or mannose-binding protein found in serum. The protein encoded belongs to the collectin family and is an important element in the innate immune system. The protein recognizes mannose and N-acetylglucosamine on many microorganisms, and is capable of activating the classical complement pathway. Deficiencies of this gene have been associated with susceptibility to autoimmune and infectious diseases. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000019622,mannan-binding lectin,mannose-binding lectin 2, soluble (opsonic defect),mannose-binding protein C,soluble mannose-binding lectin
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook