Product Browser

Last updated: 2017/11/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DKK2 (Human) Recombinant Protein

  • Catalog # : P5865
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human DKK2 (NP_055236, 34 a.a. - 259 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.
  • Sequence:
  • MGSSHHHHHHSSGLVPRGSHMGSMKLNSIKSSLGGETPGQAANRSAGMYQGLAFGGSKKGKNLGQAYPCSSDKECEVGRYCHSPHQGSSACMVCRRKKKRCHRDGMCCPSTRCNNGICIPVTESILTPHIPALDGTRHRDRNHGHYSNHDLGWQNLGRPHTKMSHIKGHEGDPCLRSSDCIEGFCCARHFWTKICKPVLHQGEVCTKQRKKGSHGLEIFQRCDCAKGLSCKVWKDATYSSKARLHVCQKI
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 27.6
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • > 90% by SDS - PAGE
  • Quality Control Testing:
  • 3 ug/lane in 15% SDS-PAGE Stained with Coomassie Blue. Due to the protein nature, dimmers and multimers may be observed.

    QC Testing of P5865
  • Storage Buffer:
  • In 20mM Tris-HCl buffer, pH 8.0 (0.4M Urea, 10% glycerol).
  • Storage Instruction:
  • Store at -20°C. For long term storage store at -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • DKK2
  • Gene Alias:
  • DKK-2
  • Gene Description:
  • dickkopf homolog 2 (Xenopus laevis)
  • Gene Summary:
  • This gene encodes a protein that is a member of the dickkopf family. The secreted protein contains two cysteine rich regions and is involved in embryonic development through its interactions with the Wnt signaling pathway. It can act as either an agonist or antagonist of Wnt/beta-catenin signaling, depending on the cellular context and the presence of the co-factor kremen 2. Activity of this protein is also modulated by binding to the Wnt co-receptor LDL-receptor related protein 6 (LRP6). [provided by RefSeq
  • Other Designations:
  • dickkopf 2,dickkopf homolog 2,dickkopf related protein-2
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook