Product Browser

Last updated: 2017/8/13

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MCL1 (Human) Recombinant Protein

  • Catalog # : P5864
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human MCL1 (NP_068779, 1 a.a. - 327 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
  • Sequence:
  • MGSSHHHHHHSSGLVPRGSHMFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGSAGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVEDLEGG
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 37.2
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • > 90% by SDS - PAGE
  • Quality Control Testing:
  • 3 ug/lane in 15% SDS-PAGE Stained with Coomassie Blue. Due to the protein nature, dimmers and multimers may be observed.

    QC Testing of P5864
  • Storage Buffer:
  • In 20mM Tris-HCl buffer, pH 8.0 (0.2M NaCl, 20% glycerol, 2mM DTT).
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C or -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 4170
  • Gene Name:
  • MCL1
  • Gene Alias:
  • BCL2L3,EAT,MCL1L,MCL1S,MGC104264,MGC1839,TM
  • Gene Description:
  • myeloid cell leukemia sequence 1 (BCL2-related)
  • Gene Summary:
  • The protein encoded by this gene belongs to the Bcl-2 family. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified. The longer gene product (isoform 1) enhances cell survival by inhibiting apoptosis while the alternatively spliced shorter gene product (isoform 2) promotes apoptosis and is death-inducing. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000032794,OTTHUMP00000032795,induced myeloid leukemia cell differentiation protein Mcl-1,myeloid cell leukemia sequence 1,myeloid cell leukemia sequence 1, isoform 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook