Product Browser

Last updated: 2017/1/15

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NEU1 (Human) Recombinant Protein

  • Catalog # : P5860
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human NEU1 (NP_000425, 48 a.a. - 415 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.
  • Sequence:
  • GSSHHHHHHSSGLVPRGSHMGSHMENDFGLVQPLVTMEQLLWVSGRQIGSVDTFRIPLITATPRGTLLAFAEARKMSSSDEGAKFIALRRSMDQGSTWSPTAFIVNDGDVPDGLNLGAVVSDVETGVVFLFYSLCAHKAGCQVASTMLVWSKDDGVSWSTPRNLSLDIGTEVFAPGPGSGIQKQREPRKGRLIVCGHGTLERDGVFCLLSDDHGASWRYGSGVSGIPYGQPKQENDFNPDECQPYELPDGSVVINARNQNNYHCHCRIVLRSYDACDTLRPRDVTFDPELVDPVVAAGAVVTSSGIVFFSNPAHPEFRVNLTLRWSFSNGTSWRKETVQLWPGPSGYSSLATLEGSMDGEEQAPQLYVLYEKGRNHYTESISVAKISVYGTL
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 42.9
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • > 85% by SDS - PAGE
  • Quality Control Testing:
  • 3 ug/lane in 15% SDS-PAGE Stained with Coomassie Blue. Due to the protein nature, dimmers and multimers may be observed.

    QC Testing of P5860
  • Storage Buffer:
  • In 20mM Tris-HCl buffer, pH 8.0 (0.15M NaCl, 10% glycerol, 1mM DTT).
  • Storage Instruction:
  • Store at -20°C. For long term storage store at -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 4758
  • Gene Name:
  • NEU1
  • Gene Alias:
  • FLJ93471,NANH,NEU,SIAL1
  • Gene Description:
  • sialidase 1 (lysosomal sialidase)
  • Gene Summary:
  • The protein encoded by this gene is a lysosomal enzyme that cleaves terminal sialic acid residues from substrates such as glycoproteins and glycolipids. In the lysosome, this enzyme is part of a heterotrimeric complex together with beta-galactosidase and cathepsin A (the latter is also referred to as 'protective protein'). Mutations in this gene can lead to sialidosis, a lysosomal storage disease that can be type 1 (cherry red spot-myoclonus syndrome or normosomatic type), which is late-onset, or type 2 (the dysmorphic type), which occurs at an earlier age with increased severity. [provided by RefSeq
  • Other Designations:
  • G9 sialidase,N-acetyl-alpha-neuraminidase 1,OTTHUMP00000029419,acetylneuraminyl hydrolase,exo-alpha-sialidase,lysosomal sialidase,neuraminidase
  • RSS
  • YouTube
  • Linkedin
  • Facebook