HBA2 (Human) Recombinant Protein
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human HBA2 (NP_000508, 1 a.a. - 142 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
Sequence
MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSHMVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR
Host
Escherichia coli
Theoretical MW (kDa)
19.5
Form
Liquid
Preparation Method
Escherichia coli expression system
Purity
> 90% by SDS - PAGE
Quality Control Testing
3 ug/lane in 15% SDS-PAGE Stained with Coomassie Blue. Due to the protein nature, dimmers and multimers may be observed.
Storage Buffer
In 20 mM Tris-HCl buffer, 0.1 M NaCl, pH 8.0 (20% glycerol, 2 M urea, 2 mM DTT).
Storage Instruction
Store at 2°C to 8°C for 1 week. For long term storage, aliquot and store at -20°C to -80°C.
Aliquot to avoid repeated freezing and thawing. -
Applications
SDS-PAGE
-
Gene Info — HBA2
Entrez GeneID
3040Gene Name
HBA2
Gene Alias
-
Gene Description
hemoglobin, alpha 2
Omim ID
141850Gene Ontology
HyperlinkGene Summary
The human alpha globin gene cluster located on chromosome 16 spans about 30 kb and includes seven loci: 5'- zeta - pseudozeta - mu - pseudoalpha-1 - alpha-2 - alpha-1 - theta - 3'. The alpha-2 (HBA2) and alpha-1 (HBA1) coding sequences are identical. These genes differ slightly over the 5' untranslated regions and the introns, but they differ significantly over the 3' untranslated regions. Two alpha chains plus two beta chains constitute HbA, which in normal adult life comprises about 97% of the total hemoglobin; alpha chains combine with delta chains to constitute HbA-2, which with HbF (fetal hemoglobin) makes up the remaining 3% of adult hemoglobin. Alpha thalassemias result from deletions of each of the alpha genes as well as deletions of both HBA2 and HBA1; some nondeletion alpha thalassemias have also been reported. [provided by RefSeq
Other Designations
alpha 2 globin|alpha globin|alpha-2 globin
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com