Product Browser

Last updated: 2017/10/22

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HBA2 (Human) Recombinant Protein

  • Catalog # : P5858
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human HBA2 (NP_000508, 1 a.a. - 142 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
  • Sequence:
  • MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSHMVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 19.5
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • > 90% by SDS - PAGE
  • Quality Control Testing:
  • 3 ug/lane in 15% SDS-PAGE Stained with Coomassie Blue. Due to the protein nature, dimmers and multimers may be observed.

    QC Testing of P5858
  • Storage Buffer:
  • In 20mM Tris-HCl buffer, pH 8.0 (0.1M NaCl, 20% glycerol, 2M urea, 2mM DTT).
  • Storage Instruction:
  • Store at -20°C. For long term storage store at -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 3040
  • Gene Name:
  • HBA2
  • Gene Alias:
  • -
  • Gene Description:
  • hemoglobin, alpha 2
  • Gene Summary:
  • The human alpha globin gene cluster located on chromosome 16 spans about 30 kb and includes seven loci: 5'- zeta - pseudozeta - mu - pseudoalpha-1 - alpha-2 - alpha-1 - theta - 3'. The alpha-2 (HBA2) and alpha-1 (HBA1) coding sequences are identical. These genes differ slightly over the 5' untranslated regions and the introns, but they differ significantly over the 3' untranslated regions. Two alpha chains plus two beta chains constitute HbA, which in normal adult life comprises about 97% of the total hemoglobin; alpha chains combine with delta chains to constitute HbA-2, which with HbF (fetal hemoglobin) makes up the remaining 3% of adult hemoglobin. Alpha thalassemias result from deletions of each of the alpha genes as well as deletions of both HBA2 and HBA1; some nondeletion alpha thalassemias have also been reported. [provided by RefSeq
  • Other Designations:
  • alpha 2 globin,alpha globin,alpha-2 globin
  • RSS
  • YouTube
  • Linkedin
  • Facebook