Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PTGR1 (Human) Recombinant Protein

  • Catalog # : P5854
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PTGR1 (NP_036344, 1 a.a. - 329 a.a. ) full-length recombinant protein with His tag expressed in Escherichia coli.
  • Sequence:
  • MGSSHHHHHHSSGLVPRGSHMGSEFMVRTKTWTLKKHFVGYPTNSDFELKTAELPPLKNGEVLLEALFLTVDPYMRVAAKRLKEGDTMMGQQVAKVVESKNVALPKGTIVLASPGWTTHSISDGKDLEKLLTEWPDTIPLSLALGTVGMPGLTAYFGLLEICGVKGGETVMVNAAAGAVGSVVGQIAKLKGCKVVGAVGSDEKVAYLQKLGFDVVFNYKTVESLEETLKKASPDGYDCYFDNVGGEFSNTVIGQMKKFGRIAICGAISTYNRTGPLPPGPPPEIVIYQELRMEAFVVYRWQGDARQKALKDLLKWVLEGKIQYKEYIIEGFENMPAAFMGMLKGDNLGKTIVKA
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 38.6
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • > 90% by SDS - PAGE
  • Quality Control Testing:
  • 3 ug/lane in 15% SDS-PAGE Stained with Coomassie Blue. Due to the protein nature, dimmers and multimers may be observed.

    QC Testing of P5854
  • Storage Buffer:
  • In 20mM Tris-HCl buffer, pH7.5 (10% glycerol, 1mM DTT, 200mM NaCl).
  • Storage Instruction:
  • Store at -20°C. For long term storage store at -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • PTGR1
  • Gene Alias:
  • LTB4DH,MGC34943,ZADH3
  • Gene Description:
  • prostaglandin reductase 1
  • Gene Summary:
  • This gene encodes an enzyme that is involved in the inactivation of the chemotactic factor, leukotriene B4. The encoded protein specifically catalyzes the NADP+ dependent conversion of leukotriene B4 to 12-oxo-leukotriene B4. A pseudogene of this gene is found on chromosome 1. Alternative splicing results in multiple transcript variants. [provided by RefSeq
  • Other Designations:
  • NADP-dependent leukotriene B4 12-hydroxydehydrogenase,OTTHUMP00000021915,leukotriene B4 12-hydroxydehydrogenase,zinc binding alcohol dehydrogenase domain containing 3
  • RSS
  • YouTube
  • Linkedin
  • Facebook