Product Browser

Last updated: 2017/9/17

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CRYGN (Human) Recombinant Protein

  • Catalog # : P5851
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CRYGN (NP_653328, 1 a.a. - 182 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
  • Sequence:
  • MGSSHHHHHHSSGLVPRGSHMGSHMAQRSGKITLYEGKHFTGQKLEVFGDCDNFQDRGFMNRVNSIHVESGAWVCFNHPDFRGQQFILEHGDYPDFFRWNSHSDHMGSCRPVGMHGEHFRLEIFEGCNFTGQCLEFLEDSPFLQSRGWVKNCVNTIKVYGDGAAWSPRSFGAEDFQLSSSLQSDQGPEEATTKPATTQPPFLTANL
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 23.1
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • > 90% by SDS - PAGE
  • Quality Control Testing:
  • 3 ug/lane in 15% SDS-PAGE Stained with Coomassie Blue. Due to the protein nature, dimmers and multimers may be observed.

    QC Testing of P5851
  • Storage Buffer:
  • In 20mM Tris-HCl buffer, pH 8.0 (0.4M Urea, 10% glycerol).
  • Storage Instruction:
  • Store at -20°C. For long term storage store at -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • CRYGN
  • Gene Alias:
  • MGC119042,MGC119043,MGC119044,MGC119045
  • Gene Description:
  • crystallin, gamma N
  • Gene Summary:
  • The beta and gamma crystallins are evolutionarily related families of proteins that are localized to the refractive structure of the eye lens. The protein encoded by this gene is unique in that it has both beta and gamma crystallin protein motifs. [provided by RefSeq
  • Other Designations:
  • gammaN-crystallin
  • RSS
  • YouTube
  • Linkedin
  • Facebook