Product Browser

Last updated: 2017/9/17

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

ANAPC13 (Human) Recombinant Protein

  • Catalog # : P5847
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human ANAPC13 (NP_056206, 1 a.a. - 74 a.a.? ) full-length recombinant protein with His tag expressed in Escherichia coli.
  • Sequence:
  • MASMTGGQQMGRGSHMDSEVQRDGRILDLIDDAWREDKLPYEDVAIPLNELPEPEQDNGGTTESVKEQEMKWTDLALQYLHENVPPIGN
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 10
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • > 90% by SDS - PAGE
  • Quality Control Testing:
  • 3 ug/lane in 15% SDS-PAGE Stained with Coomassie Blue. Due to the protein nature, dimmers and multimers may be observed.

    QC Testing of P5847
  • Storage Buffer:
  • In 20mM Tris-HCl buffer, pH 8.0 (20% glycerol, 1mM DTT, 0.1M NaCl).
  • Storage Instruction:
  • Store at -20°C. For long term storage store at -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • ANAPC13
  • Gene Alias:
  • APC13,DKFZp566D193,SWM1
  • Gene Description:
  • anaphase promoting complex subunit 13
  • Gene Summary:
  • This gene encodes a component of the anaphase promoting complex, a large ubiquitin-protein ligase that controls cell cycle progression by regulating the degradation of cell cycle regulators such as B-type cyclins. The encoded protein is evolutionarily conserved and is required for the integrity and ubiquitin ligase activity of the anaphase promoting complex. Pseudogenes and splice variants have been found for this gene; however, the biological validity of some of the splice variants has not been determined. [provided by RefSeq
  • Other Designations:
  • cyclosome subunit 13,homolog of yeast Swm1
  • RSS
  • YouTube
  • Linkedin
  • Facebook