Product Browser

Last updated: 2017/5/21

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TXNDC12 (Human) Recombinant Protein

  • Catalog # : P5844
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human TXNDC12 (NP_056997, 27 a.a. - 172 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.
  • Sequence:
  • MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSHMHNGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPKDEDFSPDGGYIPRILFLDPSGKVHPEIINENGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFRKKHLEDEL
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 20.8
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • > 90% by SDS - PAGE
  • Quality Control Testing:
  • 3 ug/lane in 15% SDS-PAGE Stained with Coomassie Blue. Due to the protein nature, dimmers and multimers may be observed.

    QC Testing of P5844
  • Storage Buffer:
  • In 20mM Tris-HCl buffer, pH 8.0 (0.15M NaCl, 10% glycerol).
  • Storage Instruction:
  • Store at -20°C. For long term storage store at -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • TXNDC12
  • Gene Alias:
  • AGR1,ERP18,ERP19,TLP19,hAG-1
  • Gene Description:
  • thioredoxin domain containing 12 (endoplasmic reticulum)
  • Gene Summary:
  • TXNDC12 belongs to the thioredoxin superfamily (see TXN; MIM 187700). Members of this superfamily possess a thioredoxin fold with a consensus active-site sequence (CxxC) and have roles in redox regulation, defense against oxidative stress, refolding of disulfide-containing proteins, and regulation of transcription factors (Liu et al., 2003 [PubMed 14557066]).[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000010300,anterior gradient homolog 1,endoplasmic reticulum thioredoxin superfamily member, 18 kDa,thioredoxin-like protein p19
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook