Product Browser

Last updated: 2017/4/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

EIF4H (Human) Recombinant Protein

  • Catalog # : P5402
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human EIF4H (NP_001098751, 1 a.a. - 140 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
  • Sequence:
  • MGSSHHHHHHSSGLVPRGSHMGSHMADFDTYDDRAYSSFGGGRGSRGSAGGHGSRSQKELPTEPPYTAYVGNLPFNTVQGDIDAIFKDLS IRSVRLVRDKDTDKFKGFCYVEFDEVDSLKEALTYDGALLGDRSLRVDIAEGRKQDKGGFGFRKGGPDDRGMGSSRESRGGWDSRDDFNS GFRDDFLGGRGGSRPGDRRTGPPMGSRFRDGPPLRGSNMDFREPTEEERAQRPRLQLKPRTVATPLNQVANPNSAIFGGARPREEVVQKE QE
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 29.9
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Conventional Chromatography
  • Concentration:
  • 0.5 mg/mL
  • Quality Control Testing:
  • Loading 3 ug protein in 15% SDS-PAGE

    QC Testing of P5402
  • Storage Buffer:
  • In 20 mM Tris-HCl, 0.2 M NaCl, pH 8.0 (50% glycerol, 2 mM DTT)
  • Storage Instruction:
  • Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 7458
  • Gene Name:
  • EIF4H
  • Gene Alias:
  • KIAA0038,WBSCR1,WSCR1
  • Gene Description:
  • eukaryotic translation initiation factor 4H
  • Gene Summary:
  • This gene encodes one of the translation initiation factors, which functions to stimulate the initiation of protein synthesis at the level of mRNA utilization. This gene is deleted in Williams syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at 7q11.23. Alternative splicing of this gene generates 2 transcript variants. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000024643,Williams-Beuren syndrome chromosome region 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook