Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CD274 (Human) Recombinant Protein

  • Catalog # : P5397
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CD274 (NP_054862, 19 a.a. - 238 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.
  • Sequence:
  • MGSSHHHHHHSSGLVPRGSHMGSHMFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNER
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 27.9
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Conventional Chromatography
  • Concentration:
  • 1 mg/mL
  • Purity:
  • > 90% by SDS-PAGE
  • Quality Control Testing:
  • Loading 3 ug protein in 15% SDS-PAGE

    QC Testing of P5397
  • Storage Buffer:
  • In 20 mM Tris-HCl, pH 8.0 (10% glycerol, 1 mM DTT)
  • Storage Instruction:
  • Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • CD274
  • Gene Alias:
  • B7-H,B7H1,MGC142294,MGC142296,PD-L1,PDCD1L1,PDCD1LG1,PDL1
  • Gene Description:
  • CD274 molecule
  • Other Designations:
  • CD274 antigen,OTTHUMP00000021029,programmed cell death 1 ligand 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook