Product Browser

Last updated: 2017/4/30

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

LSM2 (Human) Recombinant Protein

  • Catalog # : P5391
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human LSM2 (NP_067000, 1 a.a. - 95 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
  • Sequence:
  • MGSSHHHHHHSSGLVPRGSHMGSHMLFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNCFIRGSVVRYVQLPADEVDTQLLQDAARKEALQQKQ
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 13.4
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Conventional Chromatography
  • Concentration:
  • 0.5 mg/mL
  • Purity:
  • > 90% by SDS-PAGE
  • Quality Control Testing:
  • Loading 3 ug protein in 15% SDS-PAGE

    QC Testing of P5391
  • Storage Buffer:
  • In 20 mM Tris-HCl, 200 mM NaCl, pH 8.0 (5 mM DTT, 40% glycerol)
  • Storage Instruction:
  • Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • LSM2
  • Gene Alias:
  • C6orf28,G7b,YBL026W,snRNP
  • Gene Description:
  • LSM2 homolog, U6 small nuclear RNA associated (S. cerevisiae)
  • Gene Summary:
  • Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; MIM 601061). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.[supplied by OMIM
  • Other Designations:
  • LSM2 homolog, U6 small nuclear RNA associated,OTTHUMP00000029159,U6 snRNA-associated Sm-like protein
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook