Product Browser

Last updated: 2017/2/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PAK4 (Human) Recombinant ProteinBioActive

  • Catalog # : P5384
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human PAK4 kinase domain (O96013, 300 a.a. - 591 a.a.) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • GPHMSHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQRRELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRKSLVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNLHKVSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAKAGPPASIVPLMRQNRT
    The first 4 residues GPHM are from Turbo3C Protease cleavage site. The underlined S is phosphorylated S474.
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 33.3
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Concentration:
  • 1 mg/ml
  • Activity:
  • Specific activity: 5,595 pmoles/min/ug
  • Quality Control Testing:
  • Loading 7 ug protein in SDS-PAGE

    QC Testing of P5384
  • Storage Buffer:
  • In 25 mM Tris-HCl pH 8.0, 150 mM NaCl, 10% glycerol, 5 mM DTT.
  • Storage Instruction:
  • Store at -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Result of activity analysis
  • Analysis of enzymatic activity was performed according to the Zlyte assay protocol (Invitrogen):
    1. Different concentrations of PAK4 were incubated in a buffer containing 50 mM HEPES pH 7.5, 10 mM MgCl2, 1 mM EGTA, 200 uM ATP, 0.01% Brij-35, and 2 uM substrate (SER/THR 14, Invitrogen) at RT for 1 hour.
    2. Developer solution was added to the reaction and the reaction was stopped after 1 hour of incubation at RT.
    3. Fluorescence was then detected using λexc=460±40 nm and λem=528±20 nm filters.


  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • PAK4
  • Gene Alias:
  • -
  • Gene Description:
  • p21 protein (Cdc42/Rac)-activated kinase 4
  • Gene Summary:
  • PAK proteins, a family of serine/threonine p21-activating kinases, include PAK1, PAK2, PAK3 and PAK4. PAK proteins are critical effectors that link Rho GTPases to cytoskeleton reorganization and nuclear signaling. They serve as targets for the small GTP binding proteins Cdc42 and Rac and have been implicated in a wide range of biological activities. PAK4 interacts specifically with the GTP-bound form of Cdc42Hs and weakly activates the JNK family of MAP kinases. PAK4 is a mediator of filopodia formation and may play a role in the reorganization of the actin cytoskeleton. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq
  • Other Designations:
  • p21(CDKN1A)-activated kinase 4,p21-activated kinase 4,protein kinase related to S. cerevisiae STE20, effector for Cdc42Hs
  • RSS
  • YouTube
  • Linkedin
  • Facebook