PAK4 (Human) Recombinant Protein
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Result of activity analysis
Result of activity analysis
Analysis of enzymatic activity was performed according to the Zlyte assay protocol (Invitrogen):
1. Different concentrations of PAK4 were incubated in a buffer containing 50 mM HEPES pH 7.5, 10 mM MgCl2, 1 mM EGTA, 200 uM ATP, 0.01% Brij-35, and 2 uM substrate (SER/THR 14, Invitrogen) at RT for 1 hour.
2. Developer solution was added to the reaction and the reaction was stopped after 1 hour of incubation at RT.
3. Fluorescence was then detected using λexc=460±40 nm and λem=528±20 nm filters.
-
Specification
Product Description
Human PAK4 kinase domain (O96013, 300 a.a. - 591 a.a.) partial recombinant protein expressed in Escherichia coli.
Sequence
GPHMSHEQFRAALQLVVDPGDPRSYLDNFIKIGEGSTGIVCIATVRSSGKLVAVKKMDLRKQQRRELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTRMNEEQIAAVCLAVLQALSVLHAQGVIHRDIKSDSILLTHDGRVKLSDFGFCAQVSKEVPRRKSLVGTPYWMAPELISRLPYGPEVDIWSLGIMVIEMVDGEPPYFNEPPLKAMKMIRDNLPPRLKNLHKVSPSLKGFLDRLLVRDPAQRATAAELLKHPFLAKAGPPASIVPLMRQNRT
The first 4 residues GPHM are from Turbo3C Protease cleavage site. The underlined S is phosphorylated S474.Host
Escherichia coli
Theoretical MW (kDa)
33.3
Form
Liquid
Preparation Method
Escherichia coli expression system
Concentration
1 mg/ml
Activity
Specific activity: 5,595 pmoles/min/ug
Quality Control Testing
Loading 7 ug protein in SDS-PAGE
Storage Buffer
In 25 mM Tris-HCl pH 8.0, 150 mM NaCl, 10% glycerol, 5 mM DTT.
Storage Instruction
Store at -80°C.
Aliquot to avoid repeated freezing and thawing.Note
Result of activity analysis
-
Applications
Functional Study
SDS-PAGE
-
Gene Info — PAK4
Entrez GeneID
10298Protein Accession#
O96013Gene Name
PAK4
Gene Alias
-
Gene Description
p21 protein (Cdc42/Rac)-activated kinase 4
Omim ID
605451Gene Ontology
HyperlinkGene Summary
PAK proteins, a family of serine/threonine p21-activating kinases, include PAK1, PAK2, PAK3 and PAK4. PAK proteins are critical effectors that link Rho GTPases to cytoskeleton reorganization and nuclear signaling. They serve as targets for the small GTP binding proteins Cdc42 and Rac and have been implicated in a wide range of biological activities. PAK4 interacts specifically with the GTP-bound form of Cdc42Hs and weakly activates the JNK family of MAP kinases. PAK4 is a mediator of filopodia formation and may play a role in the reorganization of the actin cytoskeleton. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq
Other Designations
p21(CDKN1A)-activated kinase 4|p21-activated kinase 4|protein kinase related to S. cerevisiae STE20, effector for Cdc42Hs
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com