PAK2 (Human) Recombinant Protein
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Result of activity analysis
Result of activity analysis
Analysis of enzymatic activity was performed according to the Zlyte assay protocol (Invitrogen):
1. Different concentrations of PAK2 were incubated in a buffer containing 50 mM HEPES pH 7.5, 10 mM MgCl2, 1 mM EGTA, 200 uM ATP, 0.01% Brij-35, and 2 uM substrate (SER/THR 14, Invitrogen) at RT for 1 hour.
2. Developer solution was added to the reaction and the reaction was stopped after 1 hour of incubation at RT.
3. Fluorescence was then detected using λexc=460±40 nm and λem=528±20 nm filters.
-
Specification
Product Description
Human PAK2 kinase domain (Q13177, 227 a.a. - 524 a.a.) partial recombinant protein expressed in Escherichia coli.
Sequence
GPHMTDEEIMEKLRTIVSIGDPKKKYTRYEKIGQGASGTVFTATDVALGQEVAIKQINLQKQPKKELIINEILVMKELKNPNIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQVIHRDIKSDNVLLGMEGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPIFRDFLNRCLEMDVEKRGSAKELLQHPFLKLAKPLSSLTPLIMAAKEAMKSNR
The first 4 residues GPHM are from Turbo3C Protease cleavage site. The underlined T is phosphorylated T402.Host
Escherichia coli
Theoretical MW (kDa)
33.5
Form
Liquid
Preparation Method
Escherichia coli expression system
Concentration
1 mg/ml
Activity
Specific activity: 85,806 pmoles/min/ug
Quality Control Testing
Loading 6 ug protein in SDS-PAGE
Storage Buffer
In 25 mM Tris-HCl pH 8.0, 150 mM NaCl, 10% glycerol, 5 mM DTT.
Storage Instruction
Store at -80°C.
Aliquot to avoid repeated freezing and thawing.Note
Result of activity analysis
-
Applications
Functional Study
SDS-PAGE
-
Gene Info — PAK2
Entrez GeneID
5062Protein Accession#
Q13177Gene Name
PAK2
Gene Alias
PAK65, PAKgamma
Gene Description
p21 protein (Cdc42/Rac)-activated kinase 2
Omim ID
605022Gene Ontology
HyperlinkGene Summary
The p21 activated kinases (PAK) are critical effectors that link Rho GTPases to cytoskeleton reorganization and nuclear signaling. The PAK proteins are a family of serine/threonine kinases that serve as targets for the small GTP binding proteins, CDC42 and RAC1, and have been implicated in a wide range of biological activities. The protein encoded by this gene is activated by proteolytic cleavage during caspase-mediated apoptosis, and may play a role in regulating the apoptotic events in the dying cell. [provided by RefSeq
Other Designations
S6/H4 kinase|p21 (CDKN1A)-activated kinase 2|p21-activated kinase 2
-
Interactome
-
Pathway
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com