PAK1 (Human) Recombinant Protein
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human PAK1 kinase domain (Q13153, 248 a.a. - 545 a.a.) partial recombinant protein expressed in Escherichia coli. The recombinant protein does not have the inhibitory switch domain and has high specific activity.
Sequence
GPHMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQMNLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGTPELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEATKNNH
The first 4 residues GPHM are from Turbo3C Protease cleavage site. The underlined T is phosphorylated T423.Host
Escherichia coli
Theoretical MW (kDa)
33.7
Form
Liquid
Preparation Method
Escherichia coli expression system
Concentration
1 mg/ml
Activity
Specific activity: 32,638 pmoles/min/ug
Quality Control Testing
Loading 8 ug protein in SDS-PAGE
Storage Buffer
In 25 mM Tris-HCl pH 8.0, 150 mM NaCl, 10% glycerol, 5 mM DTT.
Storage Instruction
Store at -80°C.
Aliquot to avoid repeated freezing and thawing.Note
Result of activity analysis
-
Applications
Functional Study
SDS-PAGE
-
Gene Info — PAK1
Entrez GeneID
5058Protein Accession#
Q13153Gene Name
PAK1
Gene Alias
MGC130000, MGC130001, PAKalpha
Gene Description
p21 protein (Cdc42/Rac)-activated kinase 1
Omim ID
602590Gene Ontology
HyperlinkGene Summary
PAK proteins are critical effectors that link RhoGTPases to cytoskeleton reorganization and nuclear signaling. PAK proteins, a family of serine/threonine p21-activating kinases, include PAK1, PAK2, PAK3 and PAK4. These proteins serve as targets for the small GTP binding proteins Cdc42 and Rac and have been implicated in a wide range of biological activities. PAK1 regulates cell motility and morphology. Alternativelt spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Other Designations
STE20 homolog, yeast|p21-activated kinase 1|p21/Cdc42/Rac1-activated kinase 1 (STE20 homolog, yeast)|p21/Cdc42/Rac1-activated kinase 1 (yeast Ste20-related)
-
Interactome
-
Pathway
-
Disease
-
Publication Reference
-
Pak1 Kinase Maintains Apical Membrane Identity in Epithelia.
Aguilar-Aragon M, Elbediwy A, Foglizzo V, Fletcher GC, Li VSW, Thompson BJ.
Cell Reports 2018 Feb; 22:1639.
Application:In vitro kinase assay, PAK1 protein.
-
Rho-Kinase Planar Polarization at Tissue Boundaries Depends on Phospho-regulation of Membrane Residence Time.
Sidor C, Stevens TJ, Jin L, Boulanger J, Röper K.
The Annals of Thoracic Surgery 1991 May; 51(5):848.
Application:KA, Recombinant protein.
-
Pak1 Kinase Maintains Apical Membrane Identity in Epithelia.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com