Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

Ifng (Rat) Recombinant ProteinBioActive

  • Catalog # : P5152
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rat Ifng (P01581) recombinant protein expressed in Escherichia coli.
  • Sequence:
  • QGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 16
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Ion exchange column and HPLC reverse phase column
  • Purity:
  • > 90% by SDS-PAGE and HPLC
  • Endotoxin Level:
  • Endotoxin content was assayed using a LAL gel clot method. Endotoxin level was found to be less than 0.1 ng/ug (1EU/ug).
  • Activity:
  • The ED(50) was determined by the cytopathic inhibition assay with murine L929 cells infected by EMC virus, and was found to be < 1 ng/mL, corresponding to a specific activity of > 1 x 106 units/mg.
  • Storage Buffer:
  • Lyophilized from PBS, pH 7.0
  • Storage Instruction:
  • Store at -20°C on dry atmosphere.
    After reconstitution with sterilized water, store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • Ifng
  • Gene Alias:
  • IFNG2
  • Gene Description:
  • interferon gamma
  • Other Designations:
  • -
  • RSS
  • YouTube
  • Linkedin
  • Facebook