Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CCL28 (Human) Recombinant ProteinBioActive

  • Catalog # : P5125
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CCL28 (108 amino acids) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • SEAILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKR RRICVSPHNHTVKQWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHE TYGHKTPY
  • Host:
  • Escherichia coli
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • > 97% by SDS-PAGE and RP-HPLC
  • Activity:
  • Determined by its ability to chemoattract human lymphocytes using a concentration range of 1.0-10.0 ng/mL.
  • Storage Buffer:
  • Lyophilized from 20 mM PBS, 150 mM NaCl
  • Storage Instruction:
  • Store at -20°C on dry atmosphere.
    After reconstitution, store at -20°C or lower.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • CCL28
  • Gene Alias:
  • CCK1,MEC,MGC71902,SCYA28
  • Gene Description:
  • chemokine (C-C motif) ligand 28
  • Gene Summary:
  • This gene belongs to the subfamily of small cytokine CC genes. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The cytokine encoded by this gene displays chemotactic activity for resting CD4 or CD8 T cells and eosinophils. The product of this gene binds to chemokine receptors CCR3 and CCR10. This chemokine may play a role in the physiology of extracutaneous epithelial tissues, including diverse mucosal organs. [provided by RefSeq
  • Other Designations:
  • CC chemokine CCL28,mucosae-associated epithelial chemokine,small inducible cytokine A28,small inducible cytokine subfamily A (Cys-Cys), member 28
  • RSS
  • YouTube
  • Linkedin
  • Facebook