Product Browser

Last updated: 2020/9/20

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HBsAg (adw) Recombinant Protein 

  • Catalog # : P5118
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • HBsAg (adw) partial recombinant protein expressed in Pichia pastoris.
  • Sequence:
  • MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSKFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVWFVGLSPTVWLSAIWMMWYWGPSLYSIVSPFIPLLPIFFCLWVYI (Genebank accession#,CAA05872).
  • Host:
  • Yeast
  • Theoretical MW (kDa):
  • 24
  • Form:
  • Liquid
  • Preparation Method:
  • Yeast expression system
  • Purity:
  • > 95% by SDS-PAGE
  • Recommend Usage:
  • ELISA
    Western Blot
    The optimal working dilution should be determined by the end user.
  • Storage Buffer:
  • In 20 mM phosphate buffer, 154 mM NaCl2.
  • Storage Instruction:
  • Store at 4°C for immediate use. Store at -20°C for 6 months.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot
  • Enzyme-linked Immunoabsorbent Assay
  • Application Image
  • Western Blot
  • Enzyme-linked Immunoabsorbent Assay
  • RSS
  • YouTube
  • Linkedin
  • Facebook