Product Browser

Last updated: 2017/7/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GST (Schistosoma japonicum) Recombinant ProteinBioActive

  • Catalog # : P4994
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Schistosoma japonicum GST (P08515, 1 a.a. - 224 a.a.) full-length recombinant protein with His tag expressed in Escherichia coli.
  • Sequence:
  • MGSSHHHHHHSSGLVPRGSHMSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLVPR
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 28.3
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Conventional Chromatography
  • Concentration:
  • 1 mg/mL
  • Purity:
  • > 95% by SDS-PAGE
  • Activity:
  • Specific activity is 2.8-3.3 units/mg, and is defined as the amount of enzyme that conjugate 1.0 umole of 1-chloro-2,4-dinitrobenzene (CDNB) with reduced glutathione per minute at pH 6.5 at 25°C.
  • Quality Control Testing:
  • Loading 3 ug protein in 15% SDS-PAGE

    QC Testing of P4994
  • Storage Buffer:
  • In PBS, pH 7.4 (10% glycerol)
  • Storage Instruction:
  • Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • RSS
  • YouTube
  • Linkedin
  • Facebook