Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

Trl (Fruit fly) Recombinant Protein

  • Catalog # : P4986
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Fruit fly Trl (NP_996080, 1 a.a. - 130 a.a.) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • MSLPMNSLYSLTWGDYGTSLVSAIQLLRCHGDLVDCTLAAGGRSFPAHKIVLCAASPFLLDLLKNTPCKHPVVMLAGVNANDLEALLEFVYRGEVSVDHAQLPSLLQAAQCLNIQGLAPQTVTKDDYTTH
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 14
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Conventional Chromatography
  • Concentration:
  • 1 mg/mL
  • Purity:
  • > 95% by SDS-PAGE
  • Quality Control Testing:
  • Loading 3 ug protein in 14% SDS-PAGE

    QC Testing of P4986
  • Storage Buffer:
  • In 10 mM HEPES, 25 mM NaCl, pH 7.4
  • Storage Instruction:
  • Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • Trl
  • Gene Alias:
  • Adf-2,Adf-2-519,Adf2,CG33261,CG9343,E(var)3-trl,E(var)62,GAF,GAGA,NC70F,TfGAGA/Adf-2,Trl-GAGA,anon-EST:fe2E12,l(3)s2325,unnamed
  • Gene Description:
  • Trithorax-like
  • Other Designations:
  • Adh transcription factor 2,GAGA element,GAGA factor,GAGA transcription factor,Neural conserved at 70F,Trithorax-like CG33261-PA, isoform A,Trithorax-like CG33261-PB, isoform B,Trithorax-like CG33261-PC, isoform C,Trithorax-like CG33261-PD, isoform D,Trith
  • RSS
  • YouTube
  • Linkedin
  • Facebook