Product Browser

Last updated: 2016/11/27

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

trxA (Escherichia coli) Recombinant proteinBioActive

  • Catalog # : P4981
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Escherichia coli trxA (ACB04810, 2 a.a. - 109 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.
  • Sequence:
  • MHHHHHHMGSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAGS
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 34.6
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Conventional Chromatography
  • Concentration:
  • 0.5 mg/mL
  • Purity:
  • > 85% by SDS-PAGE
  • Activity:
  • Specific activity is 16~18 A650/min/mg and was obtained by measuring the increase of insulin precipitation in absorbance at 650 nm resulting from the reduction of insulin.
  • Quality Control Testing:
  • 15% SDS-PAGE Stained with Coomassie Blue

    QC Testing of P4981
  • Storage Buffer:
  • In 20 mM Tris-HCl, pH 8.0 (1 mM DTT, 10% glycerol)
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C or -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • trxA
  • Gene Alias:
  • -
  • Gene Description:
  • thioredoxin 1
  • Other Designations:
  • -
  • RSS
  • YouTube
  • Linkedin
  • Facebook