Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

fur (Escherichia coli) Recombinant protein

  • Catalog # : P4972
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Escherichia coli fur (NP_415209, 1 a.a. - 148 a.a.) full-length recombinant protein expressed in Escherichia coli.
  • Sequence:
  • MTDNNTALKKAGLKVTLPRLKILEVLQEPDNHHVSAEDLYKRLIDMGEEIGLATVYRVLNQFDDAGIVTRHNFEGGKSVFELTQQHHHDHLICLDCGKVIEFSDDSIEARQREIAAKHGIRLTNHSLYLYGHCAEGDCREDEHAHEGK
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 42
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Conventional Chromatography
  • Concentration:
  • 1 mg/mL
  • Purity:
  • > 95% by SDS-PAGE
  • Quality Control Testing:
  • 15% SDS-PAGE Stained with Coomassie Blue

    QC Testing of P4972
  • Storage Buffer:
  • In 20 mM Tris, 2 mM CaCl2, 100mM NaCl, pH 8.0
  • Storage Instruction:
  • Store at -20°C. For long term storage store at -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • fur
  • Gene Alias:
  • ECK0671,JW0669
  • Gene Description:
  • DNA-binding transcriptional dual regulator of siderophore biosynthesis and transport
  • Other Designations:
  • -
  • RSS
  • YouTube
  • Linkedin
  • Facebook