Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

dnaK (Escherichia coli) Recombinant protein

  • Catalog # : P4965
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Escherichia coli dnaK (NP_414555, 385 a.a. - 638 a.a.) partial recombinant protein expressed in Escherichia coli.
  • Sequence:
  • MDVKDVLLLDVTPLSLGIETMGGVMTTLIAKNTTIPTKHSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNLDGINPAPRGMPQIEVTFDIDADGILHVSAKDKNSGKEQKITIKASSGLNEDEIQKMVRDAEANAEADRKFEELVQTRNQGDHLLHSTRKQVEEAGDKLPADDKTAIESALTALETALKGEDKAAIEAKMQELAQVSQKLMEIAQQQHAQQQTAGADASANNAKDDDVVDAEFEEVKDKK
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 41.6
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Purification:
  • Conventional Chromatography
  • Concentration:
  • 1 mg/mL
  • Purity:
  • > 95% by SDS-PAGE
  • Quality Control Testing:
  • 15% SDS-PAGE Stained with Coomassie Blue

    QC Testing of P4965
  • Storage Buffer:
  • In 25 mM Tris-HCl, 100 mM NaCl, pH 7.5 (5 mM DTT, 10% glycerol)
  • Storage Instruction:
  • Store at -20°C. For long term storage store at -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • dnaK
  • Gene Alias:
  • ECK0014,JW0013,groPAB,groPC,groPF,grpC,grpF,seg
  • Gene Description:
  • chaperone Hsp70, co-chaperone with DnaJ
  • Other Designations:
  • -
  • RSS
  • YouTube
  • Linkedin
  • Facebook