Product Browser

Last updated: 2017/7/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

BTLA (Human) Recombinanat Protein

  • Catalog # : P4939
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human BTLA recombinanat protein fused to murine IgG2a Fc and hinge region purifird from CHO cells.
  • Sequence:
  • BTLA mature: ipyldiwnihgkescdvqlyikrqsehsilagdpfelecpvkycanrphvtwcklngttcvkledrqtswkeeknisffilhfepvlpndngsyrcsanfqsnli eshsttlyvtdvksaserpskdemasrp
    Linker +Murine IgG2a Hinge + Fc: gteprgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpkgsvrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklrvekknwverns yscsvvheglhnhhttksfsrtpg
  • Host:
  • Hamster
  • Form:
  • Liquid
  • Preparation Method:
  • Mammalian cell (CHO) expression system
  • Purification:
  • Affinity and size purification
  • Concentration:
  • 0.5 mg/mL
  • Purity:
  • > 90% by SDS-PAGE
  • Storage Buffer:
  • In 50 mM sodium phosphate, 100 mM potassium chloride, 150 mM NaCl, pH 7.5. (0.5 mg/mL gentamicin sulfate)
  • Storage Instruction:
  • Store at 4°C. This product is stable for at least 3 months.
  • Applications
  • Application Image
  • Gene Information
  • Gene Name:
  • BTLA
  • Gene Alias:
  • BTLA1,CD272,FLJ16065,MGC129743
  • Gene Description:
  • B and T lymphocyte associated
  • Gene Summary:
  • BTLA expression is induced during activation of T cells, and BTLA remains expressed on Th1 cells but not Th2 cells. Like PD1 (MIM 600244) and CTLA4 (MIM 123890), BTLA interacts with a B7 homolog, B7H4.[supplied by OMIM
  • Other Designations:
  • B and T lymphocyte attenuator
  • RSS
  • YouTube
  • Linkedin
  • Facebook