Product Browser

Last updated: 2017/8/13

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CD274 (Human) Recombinanat Protein

  • Catalog # : P4938
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CD274 recombinanat protein fused to murine IgG2a Fc and hinge region purifird from CHO cells.
  • Sequence:
  • CD274 mature: ftvtvpkdlyvveygsnmtieckfpvekqldlaalivywemedkniiqfvhgeedlkvqhssyrqrarllkdqlslgnaalqitdvklqdagvyrcmisyggadykritvkvnapynkinqrilvvdpvtseheltcqaegypkaeviwtssdhqvlsgkttttnskreeklfnvtstlrintttneifyctfrrldpeenhtaelvipelplahppnerthtr
    Linker +Murine IgG2a Hinge + Fc: gteprgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpkgsvrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklrvekknwvernsyscsvvheglhnhhttksfsrtpg
  • Host:
  • Hamster
  • Form:
  • Liquid
  • Preparation Method:
  • Mammalian cell (CHO) expression system
  • Purification:
  • Affinity and size purification
  • Concentration:
  • 0.5 mg/mL
  • Storage Buffer:
  • In 50 mM sodium phosphate, 100 mM potassium chloride, 150 mM NaCl, pH 7.5. (0.5 mg/mL gentamicin sulfate)
  • Storage Instruction:
  • Store at 4°C. This product is stable for at least 3 months.
  • Applications
  • Application Image
  • Gene Information
  • Gene Name:
  • CD274
  • Gene Alias:
  • B7-H,B7H1,MGC142294,MGC142296,PD-L1,PDCD1L1,PDCD1LG1,PDL1
  • Gene Description:
  • CD274 molecule
  • Other Designations:
  • CD274 antigen,OTTHUMP00000021029,programmed cell death 1 ligand 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook