Product Browser

Last updated: 2017/12/10

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

TNFRSF4 (Human) Recombinanat Protein

  • Catalog # : P4934
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human TNFRSF4 recombinanat protein fused to murine IgG2a Fc purifird from CHO cells.
  • Sequence:
  • TNFRSF4 mature: lhcvgdtypsndrcchecrpgngmvsrcsrsqntvcrpcgpgfyndvvsskpckpctwcnlrsgserkqlctatqdtvcrcragtqpldsykpgvdcapcppghfspgdnqackpwtnctlagkhtlqpasnssdaicedrdppatqpqetqgpparpitvqpteawprtsqgpstr
    Fused to murine IgG2a Fc: eprgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpkgsvrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklrvekknwvernsyscsvvheglhnhhttksfsrtpg
  • Host:
  • Hamster
  • Theoretical MW (kDa):
  • 45.6
  • Form:
  • Liquid
  • Preparation Method:
  • Mammalian cell (CHO) expression system
  • Purification:
  • Size purification
  • Concentration:
  • 0.5 mg/mL
  • Storage Buffer:
  • In 50 mM sodium phosphate, 100 mM NaCl, pH 7.6. (0.5 mg/mL gentamicin sulfate)
  • Storage Instruction:
  • Store at 4°C. This product is stable for at least 3 months.
  • Applications
  • Application Image
  • Gene Information
  • Entrez GeneID:
  • 7293
  • Gene Name:
  • Gene Alias:
  • ACT35,CD134,OX40,TXGP1L
  • Gene Description:
  • tumor necrosis factor receptor superfamily, member 4
  • Gene Summary:
  • The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor has been shown to activate NF-kappaB through its interaction with adaptor proteins TRAF2 and TRAF5. Knockout studies in mice suggested that this receptor promotes the expression of apoptosis inhibitors BCL2 and BCL2lL1/BCL2-XL, and thus suppresses apoptosis. The knockout studies also suggested the roles of this receptor in CD4+ T cell response, as well as in T cell-dependent B cell proliferation and differentiation. [provided by RefSeq
  • Other Designations:
  • ATC35 antigen,CD134 antigen,OTTHUMP00000001522,OX40 antigen,OX40 cell surface antigen,OX40 homologue,lymphoid activation antigene ACT35,tax-transcriptionally activated glycoprotein 1 receptor
  • RSS
  • YouTube
  • Linkedin
  • Facebook