Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CTLA4 (Human) Recombinanat Protein

  • Catalog # : P4933
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CTLA4 recombinant protein fused to murine IgG2a Fc purified from CHO cells.
  • Sequence:
  • CTLA4 mature: mhvaqpavvlassrgiasfvceyaspgkatevrvtvlrqadsqvtevcaatymtgneltflddsictgtssgnqvnltiqglramdtglyickvelmypppyylgigngtqiyvidpepcpdsdf
    Fused to murine IgG2a Fc: eprgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpkgsvrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklrvekknwvernsyscsvvheglhnhhttksfsrtpgk
  • Host:
  • Hamster
  • Form:
  • Liquid
  • Preparation Method:
  • Mammalian cell (CHO) expression system
  • Purification:
  • Protein A purification
  • Concentration:
  • 0.5 mg/mL
  • Purity:
  • > 95% by SDS-PAGE
  • Storage Buffer:
  • In 50 mM sodium phosphate, 100 mM potassium chloride, 150 mM NaCl, pH 7.5. (0.5 mg/mL gentamicin sulfate)
  • Storage Instruction:
  • Store at 4°C. This product is stable for at least 3 months.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 1493
  • Gene Name:
  • CTLA4
  • Gene Alias:
  • CD152,CELIAC3,CTLA-4,GSE,IDDM12
  • Gene Description:
  • cytotoxic T-lymphocyte-associated protein 4
  • Gene Summary:
  • This gene is a member of the immunoglobulin superfamily and encodes a protein which transmits an inhibitory signal to T cells. The protein contains a V domain, a transmembrane domain, and a cytoplasmic tail. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. The membrane-bound isoform functions as a homodimer interconnected by a disulfide bond, while the soluble isoform functions as a monomer. Mutations in this gene have been associated with insulin-dependent diabetes mellitus, Graves disease, Hashimoto thyroiditis, celiac disease, systemic lupus erythematosus, thyroid-associated orbitopathy, and other autoimmune diseases. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000163781,cytotoxic T-lymphocyte-associated antigen 4,cytotoxic T-lymphocyte-associated serine esterase-4,ligand and transmembrane spliced cytotoxic T lymphocyte associated antigen 4
  • Interactome
  • Interactome
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook