Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MMP24 (Human) Recombinant ProteinBioActive

  • Catalog # : P4929
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human MMP24 (156 a.a. - 351 a.a.) partial recombinant protein with His tag expressed in Escherichia coli.
  • Sequence:
  • YALTGQKWRQKHITYSIHNYTPKVGELDTRKAIRQAFDVWQKVTPLTFEEVPYHEIKSDRKEADIMIFFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNANHDGNDLFLVAVHELGHALGLEHSSDPSAIMAPFYQYMETHNFKLPQDDLQGIQKIYGPPAEPLEPTRPLPTLPVRRIHSPS
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 22
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Concentration:
  • 0.2 mg/mL
  • Purity:
  • > 90% by SDS-PAGE
  • Activity:
  • >= 120 mU/mg
  • Quality Control Testing:
  • 15% SDS-PAGE Stained with Coomassie Blue

    QC Testing of P4929
  • Storage Buffer:
  • In 50 mM Tris-HCl, 150 mM NaCl, 5 mM CaCl2, pH 7.5
  • Storage Instruction:
  • Store at -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • MMP24
  • Gene Alias:
  • MMP25,MT-MMP5,MT5-MMP
  • Gene Description:
  • matrix metallopeptidase 24 (membrane-inserted)
  • Gene Summary:
  • Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. However, the protein encoded by this gene is a member of the membrane-type MMP (MT-MMP) subfamily; each member of this subfamily contains a potential transmembrane domain suggesting that these proteins are expressed at the cell surface rather than secreted. This protein activates MMP2 by cleavage. The gene has previously been referred to as MMP25 but has been renamed MMP24. [provided by RefSeq
  • Other Designations:
  • matrix metalloproteinase 24,matrix metalloproteinase 24 (membrane-inserted),membrane-type 5 matrix metalloproteinase
  • RSS
  • YouTube
  • Linkedin
  • Facebook