Product Browser

Last updated: 2017/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MMP17 (Human) Recombinant ProteinBioActive

  • Catalog # : P4928
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human MMP17 recombinant protein with His tag expressed in Escherichia coli.
  • Sequence:
  • QAPAPTKWNKRNLSWRVRTFPRDSPLGHDTVRALMYYALRVWSDIAPLNFHEVAGSTADIQIDLSKADHNDGYPFDGPGGTVAHAFFPGHHHTAGDTHFDDDEAWTFRSSDAHGMDLFAVAVHEFGHAIGLSHVAAAHSIMRPYYQGPVGDPLRYGLPYEDKVRVWQLYGVRESVSPTAQPEEPPL
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 24
  • Form:
  • Liquid
  • Preparation Method:
  • Escherichia coli expression system
  • Concentration:
  • 0.2 mg/mL
  • Purity:
  • > 80% by SDS-PAGE
  • Activity:
  • >= 6 mU/mg
  • Quality Control Testing:
  • 15% SDS-PAGE Stained with Coomassie Blue

    QC Testing of P4928
  • Storage Buffer:
  • In 50 mM Tris-HCl, 150 mM NaCl, 5 mM CaCl2, pH 7.5 (0.1% Triton X-100)
  • Storage Instruction:
  • Store at -80°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 4326
  • Gene Name:
  • MMP17
  • Gene Alias:
  • MT4-MMP
  • Gene Description:
  • matrix metallopeptidase 17 (membrane-inserted)
  • Gene Summary:
  • Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The protein encoded by this gene is considered a member of the membrane-type MMP (MT-MMP) subfamily. However, this protein is unique among the MT-MMP's in that it is a GPI-anchored protein rather than a transmembrane protein. The protein activates MMP-2 by cleavage. [provided by RefSeq
  • Other Designations:
  • matrix metalloproteinase 17,matrix metalloproteinase 17 (membrane-inserted),membrane-type matrix metalloproteinase 4,membrane-type-4 matrix metalloproteinase
  • RSS
  • YouTube
  • Linkedin
  • Facebook