Product Browser

Last updated: 2017/6/25

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HBsAg (ayw) Recombinant Protein

  • Catalog # : P4875
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • HBsAg (ayw) (CAA05872) full-length recombinanat protein expressed in yeast.
  • Sequence:
  • MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMTPSCCCTKPSDGNCTCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
  • Host:
  • Yeast
  • Theoretical MW (kDa):
  • 24
  • Form:
  • Liquid
  • Preparation Method:
  • Yeast expression system
  • Purity:
  • > 98% by SDS-PAGE
  • Storage Buffer:
  • In 50 mM phosphate buffer pH7.2, 200 mM NaCl.
  • Storage Instruction:
  • Store at 4°C. For long term storage store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • RSS
  • YouTube
  • Linkedin
  • Facebook