Product Browser

Last updated: 2017/10/15

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
pathway

IL25 (Rat) Recombinant ProteinBioActive

  • Catalog # : P4845
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rat IL25 recombinant protein expressed in Escherichia coli.
  • Sequence:
  • MCSHLPRCCPSKQQEFPEEWLKWNPAPVSPPEPLRHTHHPESCRASKDGPLNSRAISPWSYELDRDLNRVPQDLYHARCLCPHCVSLQTGSHMDPMGNSVPLYHNQTVFYRRPCHGEQGAHGRYCLERRLYRVSLACVCVRPRMMA
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 35.5
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Endotoxin Level:
  • < 0.1 EU/ug
  • Activity:
  • The activity is determined by the dose-dependent induction of human IL-8 production from human PBMCs. The expected ED50 for this effect is 25-37.5 ng/mL.
  • Quality Control Testing:
  • 1 ug/lane in 4-20% Tris-Glycine gel stained with Coomassie Blue

    QC Testing of P4845
    Lane 1: non-reducing conditions
    Lane 2: reducing conditions
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C on dry atmosphere.
    After reconstitution with sterilized 20 mM HCl, store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • IL25
  • Gene Alias:
  • IL-17E,IL-25,IL17E
  • Gene Description:
  • interleukin 25
  • Gene Summary:
  • The protein encoded by this gene is a cytokine that shares the sequence similarity with IL17. This cytokine can induce NF-kappaB activation, and stimulate the production of IL8. Both this cytokine and IL17B are ligands for the cytokine receptor IL17BR. Studies of the similar gene in mice suggested that this cytokine may be a proinflammatory cytokine favoring Th2-type immune response. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq
  • Other Designations:
  • interleukin 17E
  • RSS
  • YouTube
  • Linkedin
  • Facebook