Product Browser

Last updated: 2017/3/26

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

Pdgfb/Pdgfb (Mouse) Recombinant ProteinBioActive

  • Catalog # : P4803
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse Pdgfb (homodimer) recombinant protein expressed in Escherichia coli.
  • Sequence:
  • MSLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETIVTPRPVT
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 24.6
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Endotoxin Level:
  • < 0.1 EU/ug
  • Activity:
  • The activity is determined by the dose-dependent proliferation in mouse 3T3 fibroblasts. The expected ED50 for this effect is 0.2-0.3 ng/mL.
  • Storage Buffer:
  • Lyophilized from 10 mM sodium citrate, pH 3.0
  • Storage Instruction:
  • Store at -20°C on dry atmosphere.
    After reconstitution with sterilized water, store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Result of activity analysis
  • Serial dilutions of mouse PDGF-BB, starting at 100 ng/mL, were added to NIH 3T3 cells. After 40 hours, cell viability was measured and the linear portion of the curve was us used to calculate the ED50.


  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • Pdgfb
  • Gene Alias:
  • PDGF-B,Sis
  • Gene Description:
  • platelet derived growth factor, B polypeptide
  • Other Designations:
  • -
  • RSS
  • YouTube
  • Linkedin
  • Facebook