IL17A/IL17F (Human) Recombinant Protein
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human IL17A/IL17F (heterodimer) recombinant protein expressed in Escherichia coli.
Sequence
IL-17A: MIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
IL-17F: MRKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHHVQHost
Escherichia coli
Theoretical MW (kDa)
30.7
Form
Lyophilized
Preparation Method
Escherichia coli expression system
Endotoxin Level
< 0.1 EU/ug
Activity
The activity is determined by the dose-dependent production of IL-6 from cultured mouse NIH 3T3 fibroblasts. The expected ED50 for this effect is 2.6-3.8 ng/mL.
Quality Control Testing
1 ug/lane in 4-20% Tris-Glycine gel stained with Coomassie Blue
Lane 1: non-reducing conditions
Lane 2: reducing conditionsStorage Buffer
No additive
Storage Instruction
Store at -20°C on dry atmosphere.
After reconstitution with sterilized water, store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
Result of activity analysis
-
Applications
Functional Study
SDS-PAGE
-
Gene Info — IL17A
Entrez GeneID
3605Protein Accession#
Q16552 (Gene ID : 3605);Q96PD4 (Gene ID : 112744)Gene Name
IL17A
Gene Alias
CTLA8, IL-17, IL-17A, IL17
Gene Description
interleukin 17A
Omim ID
603149Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a proinflammatory cytokine produced by activated T cells. This cytokine regulates the activities of NF-kappaB and mitogen-activated protein kinases. This cytokine can stimulate the expression of IL6 and cyclooxygenase-2 (PTGS2/COX-2), as well as enhance the production of nitric oxide (NO). High levels of this cytokine are associated with several chronic inflammatory diseases including rheumatoid arthritis, psoriasis and multiple sclerosis. [provided by RefSeq
Other Designations
OTTHUMP00000016597|cytotoxic T-lymphocyte-associated antigen 8|cytotoxic T-lymphocyte-associated protein 8|cytotoxic T-lymphocyte-associated serine esterase 8|interleukin 17 (cytotoxic T-lymphocyte-associated serine esterase 8)
-
Gene Info — IL17F
Entrez GeneID
112744Protein Accession#
Q16552 (Gene ID : 3605);Q96PD4 (Gene ID : 112744)Gene Name
IL17F
Gene Alias
IL-17F, ML-1, ML1
Gene Description
interleukin 17F
Omim ID
606496Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a cytokine that shares sequence similarity with IL17. This cytokine is expressed by activated T cells, and has been shown to stimulate the production of several other cytokines, including IL6, IL8, and CSF2/GM_CSF. This cytokine is also found to inhibit the angiogenesis of endothelial cells and induce endothelial cells to produce IL2, TGFB1/TGFB, and monocyte chemoattractant protein-1. [provided by RefSeq
Other Designations
cytokine ML-1
-
Interactome
-
Pathway
-
Disease
- Arthritis
- Arthritis
- Asthma
- Asthma
- Behcet Syndrome
- Breast Neoplasms
- Bronchiolitis
- Cardiovascular Diseases
- Colitis
+ View More Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com