Product Browser

Last updated: 2021/4/11

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

IL17A/IL17F (Human) Recombinant Protein BioActive

  • Catalog # : P4799
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human IL17A/IL17F (heterodimer) recombinant protein expressed in Escherichia coli.
  • Sequence:
  • IL-17A: MIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA
    IL-17F: MRKIPKVGHTFFQKPESCPPVPGGSMKLDIGIINENQRVSMSRNIESRSTSPWNYTVTWDPNRYPSEVVQAQCRNLGCINAQGKEDISMNSVPIQQETLVVRRKHQGCSVSFQLEKVLVTVGCTCVTPVIHHVQ
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 30.7
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Endotoxin Level:
  • < 0.1 EU/ug
  • Activity:
  • The activity is determined by the dose-dependent production of IL-6 from cultured mouse NIH 3T3 fibroblasts. The expected ED50 for this effect is 2.6-3.8 ng/mL.
  • Quality Control Testing:
  • 1 ug/lane in 4-20% Tris-Glycine gel stained with Coomassie Blue

    QC Testing of P4799
    Lane 1: non-reducing conditions
    Lane 2: reducing conditions
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C on dry atmosphere.
    After reconstitution with sterilized water, store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Result of activity analysis

  • Serial dilutions of human IL-17 AF(starting at 1 ug/mL) were added to NIH 3T3 cells. After 48 hours, production of mouse IL-6 was measured and the linear portion of the curve was us used to calculate the ED50.


  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 3605
  • Protein Accession#:
  • Q16552 (Gene ID : 3605);Q96PD4 (Gene ID : 112744)
  • Gene Name:
  • IL17A
  • Gene Alias:
  • CTLA8,IL-17,IL-17A,IL17
  • Gene Description:
  • interleukin 17A
  • Gene Summary:
  • The protein encoded by this gene is a proinflammatory cytokine produced by activated T cells. This cytokine regulates the activities of NF-kappaB and mitogen-activated protein kinases. This cytokine can stimulate the expression of IL6 and cyclooxygenase-2 (PTGS2/COX-2), as well as enhance the production of nitric oxide (NO). High levels of this cytokine are associated with several chronic inflammatory diseases including rheumatoid arthritis, psoriasis and multiple sclerosis. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000016597,cytotoxic T-lymphocyte-associated antigen 8,cytotoxic T-lymphocyte-associated protein 8,cytotoxic T-lymphocyte-associated serine esterase 8,interleukin 17 (cytotoxic T-lymphocyte-associated serine esterase 8)
  • Gene Information
  • Protein Accession#:
  • Q16552 (Gene ID : 3605);Q96PD4 (Gene ID : 112744)
  • Gene Name:
  • IL17F
  • Gene Alias:
  • IL-17F,ML-1,ML1
  • Gene Description:
  • interleukin 17F
  • Gene Summary:
  • The protein encoded by this gene is a cytokine that shares sequence similarity with IL17. This cytokine is expressed by activated T cells, and has been shown to stimulate the production of several other cytokines, including IL6, IL8, and CSF2/GM_CSF. This cytokine is also found to inhibit the angiogenesis of endothelial cells and induce endothelial cells to produce IL2, TGFB1/TGFB, and monocyte chemoattractant protein-1. [provided by RefSeq
  • Other Designations:
  • cytokine ML-1
  • RSS
  • YouTube
  • Linkedin
  • Facebook