Product Browser

Last updated: 2017/9/24

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GSK3B (Human) Recombinant ProteinBioActive

  • Catalog # : P4698
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human GSK3B (NP_001139628.1, 1 a.a.- 420 a.a.) full-length recombinant protein with GST-His tag expressed in Sf9 cells.
  • Sequence:
  • MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHPWTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST
  • Host:
  • Insect
  • Theoretical MW (kDa):
  • 76.312
  • Form:
  • Liquid
  • Preparation Method:
  • Insect cell (Sf9) expression system
  • Purification:
  • GST affinity chromatography
  • Concentration:
  • 0.276 ug/Ul
  • Activity:
  • 13 pmol/ug x min ATP-KM: 1.4 uM
  • Quality Control Testing:
  • 2 ug/lane SDS-PAGE Stained with Coomassie Blue

    QC Testing of P4698
  • Storage Buffer:
  • In 50 mM Hepes, 100 mM NaCl, pH 7.5. (5 mM DTT, 15 mM reduced glutathione, 20% glycerol)
  • Storage Instruction:
  • Store at -80°C.
    Aliquot to avoid repeated freezing and thawing
  • Note:
  • Result of activity analysis

  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 2932
  • Gene Name:
  • GSK3B
  • Gene Alias:
  • -
  • Gene Description:
  • glycogen synthase kinase 3 beta
  • Gene Summary:
  • The protein encoded by this gene is a serine-threonine kinase, belonging to the glycogen synthase kinase subfamily. It is involved in energy metabolism, neuronal cell development, and body pattern formation. Polymorphisms in this gene have been implicated in modifying risk of Parkinson disease, and studies in mice show that overexpression of this gene may be relevant to the pathogenesis of Alzheimer disease. Alternatively spliced transcript variants encoding different isoforms have been found for this gene
  • Other Designations:
  • GSK3beta isoform,glycogen synthase kinase-3 beta
  • Interactome
  • Interactome
  • RSS
  • YouTube
  • Linkedin
  • Facebook