Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

Retnlb (Mouse) Recombinant Protein

  • Catalog # : P4630
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse Retnlb (Q99P86) recombinant protein expressed in Escherichia coli.
  • Sequence:
  • MQCSFESLVDQRIKEALSRQEPKTISCTSVTSSGRLASCPAGMVVTGCACGYGCGSWDIRNGNTCHCQCSVMDWASARCCRMA
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 8.9
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Endotoxin Level:
  • < 0.1 EU/ug
  • Quality Control Testing:
  • 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue

    QC Testing of P4630
    Lane 1: non-reducing conditions
    Lane 2: reducing conditions
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C on dry atmosphere.
    After reconstitution with sterilized water, store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • Retnlb
  • Gene Alias:
  • 9030012B21Rik,Fizz2,RELMbeta,Relmb,Xcp3
  • Gene Description:
  • resistin like beta
  • Other Designations:
  • found in inflammatory zone 2,resistin-like molecule beta
  • RSS
  • YouTube
  • Linkedin
  • Facebook