Product Browser

Last updated: 2017/6/18

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

Shh (Mouse) Recombinant ProteinBioActive

  • Catalog # : P4621
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse Shh (Q15465) recombinant protein expressed in Escherichia coli.
  • Sequence:
  • MIIGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASGRYEGKITRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAHIHCSVKAENSVAAKSGG
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 19.8
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Endotoxin Level:
  • < 0.1 EU/ug
  • Activity:
  • The activity is determined by the dose-dependent increase of alkaline phosphatase activity in C3H/10T1/2 fibroblasts (CCL-226). The expected ED50 for this effect is 0.48-0.72 ug/mL.
  • Storage Buffer:
  • Lyophilized with 10 mM Na2PO4, pH 7.5.
  • Storage Instruction:
  • Store at -20°C on dry atmosphere.
    After reconstitution with sterilized water, store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Result of activity analysis
  • Serial dilutions of mouse Shh, starting at 5 ug/mL, were added to with CCL-226 cells in the presence of 1 uM Retinoic Acid. Alkaline phosphatase was measured and the linear portion of the curve was us used to calculate the ED50.


  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • Shh
  • Gene Alias:
  • 9530036O11Rik,Dsh,Hhg1,Hx,Hxl3,M100081
  • Gene Description:
  • sonic hedgehog
  • Other Designations:
  • OTTMUSP00000023583,hemimelic extra toes,short digits
  • RSS
  • YouTube
  • Linkedin
  • Facebook