Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

Il27 (Mouse) Recombinant ProteinBioActive

  • Catalog # : P4619
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse Il27 (Q8K3I6) recombinant protein expressed in Escherichia coli.
  • Sequence:
  • MFPTDPLSLQELRREFTVSLYLARKLLSEVQGYVHSFAESRLPGVNLDLLPLGYHLPNVSLTFQAWHHLSDSERLCFLATTLRPFPAMLGGLGTQGTWTSSEREQLWAMRLDLRDLHRHLRFQVLAAGFKCSKEEEDKEEEEEEEEEEKKLPLGALGGPNQVSSQVSWPQLLYTYQLLHSLELVLSRAVRDLLLLSLPRRPGSAWDS
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 23.7
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Endotoxin Level:
  • < 0.1 EU/ug
  • Activity:
  • The activity is determined by the dose-dependent inhibition of IL-17A expression from mouse CD4+ splenocytes stimulated withTGF-beta and IL-6. 50 ng/mL of mouse p28 inhibits greater than 25% of IL-17A expression.
  • Quality Control Testing:
  • 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue

    QC Testing of P4619
    Lane 1: non-reducing conditions
    Lane 2: reducing conditions
  • Storage Buffer:
  • Lyophilized with Na2PO4, pH 7.5.
  • Storage Instruction:
  • Store at -20°C on dry atmosphere.
    After reconstitution with sterilized water, store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • Il27
  • Gene Alias:
  • IL-27,IL-27p28,Il30,p28
  • Gene Description:
  • interleukin 27
  • Other Designations:
  • IL-27 p28 subunit,interleukin 30
  • RSS
  • YouTube
  • Linkedin
  • Facebook