Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

Ccl3 (Mouse) Recombinant ProteinBioActive

  • Catalog # : P4612
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse Ccl3 (Q5QNW0) recombinant protein expressed in Escherichia coli.
  • Sequence:
  • APYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELNA
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 7.8
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Endotoxin Level:
  • < 0.1 EU/ug
  • Activity:
  • The activity is determined by the ability to chemoattract human PBMCs and THP-1 cells and is detectable starting at 1 ng/mL and 10 ng/mL respectively.
  • Quality Control Testing:
  • 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue

    QC Testing of P4612
    Lane 1: non-reducing conditions
    Lane 2: reducing conditions
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C on dry atmosphere.
    After reconstitution with sterilized water, store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Result of activity analysis
  • Human THP-1 cells were allowed to migrate to mouse Ccl3 (0, 0.1, 1, 10, 100 and 1000 ng/mL). After 45 minutes, cells that migrated were counted using a luminescent substrate and displayed on the bar graph above.


  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • Ccl3
  • Gene Alias:
  • AI323804,G0S19-1,LD78alpha,MIP-1alpha,MIP1-(a),MIP1-alpha,Mip1a,Scya3
  • Gene Description:
  • chemokine (C-C motif) ligand 3
  • Other Designations:
  • MIP-1 alpha,MIP1 (a),OTTMUSP00000000942,macrophage inflammatory protein-1alpha,small inducible cytokine A3
  • RSS
  • YouTube
  • Linkedin
  • Facebook