Product Browser

Last updated: 2021/4/11

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

Ifng (Mouse) Recombinant Protein BioActive

  • Catalog # : P4596
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse Ifng (P01580) recombinant protein expressed in Escherichia coli.
  • Sequence:
  • MHGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 15.6
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Endotoxin Level:
  • < 0.1 EU/ug
  • Activity:
  • The activity is determined by a viral challenge assay using EMC virus on L929 cells, is 1.1-1.3 x 107 Units/mg. The expected ED50 for this effect is 0.04-0.09 ng/mL.
  • Storage Buffer:
  • Lyophilized with 0.5X PBS, pH 7.2.
  • Storage Instruction:
  • Store at -20°C on dry atmosphere.
    After reconstitution with sterilized water, store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Result of activity analysis

  • The specific activity, as determined in a viral challenge assay using EMC virus on L929 cells, is 1.15-2.3 x 107 Units/mg. The corresponding ED50 is 0.086-0.043 ng/mL.


  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • Ifng
  • Gene Alias:
  • IFN-g,IFN-gamma,Ifg
  • Gene Description:
  • interferon gamma
  • Other Designations:
  • gamma interferon
  • RSS
  • YouTube
  • Linkedin
  • Facebook