Csf1 (Mouse) Recombinant Protein
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Lane 1: non-reducing conditions
Lane 2: reducing conditions
Result of activity analysis
Result of activity analysis
Serial dilutions of mouse Csf1, starting at 50 ng/mL, were added to NSF-60 cells. Cell proliferation was measured after 44 hours and the linear portion of the curve was us used to calculate the ED50.
-
Specification
Product Description
Mouse Csf1 (P07141) recombinant protein expressed in Escherichia coli.
Sequence
MKEVSEHCSHMIGNGHLKVLQQLIDSQMETSCQIAFEFVDQEQLDDPVCYLKKAFFLVQDIIDETMRFKDNTPNANATERLQELSNNLNSCFTKDYEEQNKACVRTFHETPLQLLEKIKNFFNETKNLLEKDWNIFTKNCNNSFAKCSSRDVVTKP
Host
Escherichia coli
Theoretical MW (kDa)
36.8
Form
Lyophilized
Preparation Method
Escherichia coli expression system
Endotoxin Level
< 0.1 EU/ug
Activity
The activity is determined by the dose-dependent induction of M-NFS-60 cell proliferation. The expected ED50 for this effect is 1.1-1.6 ng/mL.
Quality Control Testing
1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue
Lane 1: non-reducing conditions
Lane 2: reducing conditionsStorage Buffer
Lyophilized with 0.5X PBS, pH 8.0.
Storage Instruction
Store at -20°C on dry atmosphere.
After reconstitution with sterilized water, store at -20°C.
Aliquot to avoid repeated freezing and thawing.Note
Result of activity analysis
-
Applications
Functional Study
SDS-PAGE
-
Gene Info — Csf1
-
Publication Reference
-
Studying macrophage activation in immune-privileged lens through CSF-1 protein intravitreal injection in mouse model.
Yuting Li, Francisca M. Acosta, Yumeng Quan, Zhen Li,Sumin Gu, Jean X.Jiang.
STAR Protocols 2021 Dec; 3(1):101060.
Application：Stimulation, Mouse, Mouse eye.
-
Macrophage recruitment in immune-privileged lens during capsule repair, necrotic fiber removal, and fibrosis.
Yuting Li, Zhen Li, Yumeng Quan, Hongyun Cheng, Manuel A Riquelme, Xiao-Dong Li, Sumin Gu, Jean X Jiang.
iScience 2021 May; 24(6):102533.
Application：Sub, Mouse , Mouse eyes.
-
Studying macrophage activation in immune-privileged lens through CSF-1 protein intravitreal injection in mouse model.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com