Product Browser

Last updated: 2017/11/19

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

Il7 (Mouse) Recombinant ProteinBioActive

  • Catalog # : P4583
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse Il7 (P10168) recombinant protein expressed in Escherichia coli.
  • Sequence:
  • MECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSI
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 17.4
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Endotoxin Level:
  • < 0.1 EU/ug
  • Activity:
  • The activity is determined by dose-dependent induction of 2E8 cell proliferation and is typically less than 0.2 ng/mL.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C on dry atmosphere.
    After reconstitution with sterilized water, store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • Il7
  • Gene Alias:
  • A630026I06Rik,Il-7,MGC129342,hlb368
  • Gene Description:
  • interleukin 7
  • Other Designations:
  • -
  • RSS
  • YouTube
  • Linkedin
  • Facebook