Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IL22 (Human) Recombinant ProteinBioActive

  • Catalog # : P4580
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human IL22 (Q9GZX6) recombinant protein expressed in Escherichia coli.
  • Sequence:
  • MAPISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 33.6
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Endotoxin Level:
  • < 0.1 EU/ug
  • Activity:
  • The activity is determined by the dose-dependent induction of?IL-10 in COLO 205 cells. The expected ED50 for this effect is 125 ng/mL.
  • Quality Control Testing:
  • 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue

    QC Testing of P4580
  • Storage Buffer:
  • Lyophilized with 10 mM sodium citrate, pH 3.0.
  • Storage Instruction:
  • Store at -20°C on dry atmosphere.
    After reconstitution with sterilized water, store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • IL22
  • Gene Alias:
  • IL-21,IL-22,IL-D110,IL-TIF,IL21,ILTIF,MGC79382,MGC79384,TIFIL-23,TIFa,zcyto18
  • Gene Description:
  • interleukin 22
  • Other Designations:
  • IL-10-related T-cell-derived inducible factor,interleukin 21
  • RSS
  • YouTube
  • Linkedin
  • Facebook