Product Browser

Last updated: 2021/4/11

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location
Bulk order
Custom Services
2019 Next Day Shipping

GDF15 (D variant) (Human) Recombinant Protein BioActive

  • Catalog # : P4571
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human GDF15 (D variant) (Q99988) recombinant protein expressed in Escherichia coli.
  • Sequence:
  • MARNGDDCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 26.8
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Endotoxin Level:
  • < 0.1 EU/ug
  • Activity:
  • The activity is determined by the inhibition of DU-145 cells and is typically 1-2 ug/mL.
  • Quality Control Testing:
  • 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue

    QC Testing of P4571
    Lane 1: non-reducing conditions
    Lane 2: reducing conditions
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C on dry atmosphere.
    After reconstitution with 5 mM acetic acid, store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 9518
  • Gene Name:
  • GDF15
  • Gene Alias:
  • GDF-15,MIC-1,MIC1,NAG-1,PDF,PLAB,PTGFB
  • Gene Description:
  • growth differentiation factor 15
  • Gene Summary:
  • Bone morphogenetic proteins (e.g., BMP5; MIM 112265) are members of the transforming growth factor-beta (see TGFB1; MIM 190180) superfamily and regulate tissue differentiation and maintenance. They are synthesized as precursor molecules that are processed at a dibasic cleavage site to release C-terminal domains containing a characteristic motif of 7 conserved cysteines in the mature protein.[supplied by OMIM
  • Other Designations:
  • NSAID (nonsteroidal anti-inflammatory drug)-activated protein 1,PTGF-beta,prostate differentiation factor
  • RSS
  • YouTube
  • Linkedin
  • Facebook