Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CXCL3 (Human) Recombinant ProteinBioActive

  • Catalog # : P4570
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CXCL3 (P19876) recombinant protein expressed in Escherichia coli.
  • Sequence:
  • ASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 7.9
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Endotoxin Level:
  • < 0.1 EU/ug
  • Activity:
  • The activity is determined by the ability to chemoattract purified human neutrophils and is detectable starting at 10 ng/mL.
  • Storage Buffer:
  • Lyophilized with 10 mM Na2PO4, pH 7.5.
  • Storage Instruction:
  • Store at -20°C on dry atmosphere.
    After reconstitution with sterilized water, store at -20°C.
    Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Functional Study
  • SDS-PAGE
  • Application Image
  • Functional Study
  • SDS-PAGE
  • Gene Information
  • Entrez GeneID:
  • 2921
  • Gene Name:
  • CXCL3
  • Gene Alias:
  • CINC-2b,GRO3,GROg,MIP-2b,MIP2B,SCYB3
  • Gene Description:
  • chemokine (C-X-C motif) ligand 3
  • Other Designations:
  • GRO3 oncogene,MGSA gamma,melanoma growth stimulatory activity gamma
  • RSS
  • YouTube
  • Linkedin
  • Facebook