Product Browser

Last updated: 2018/1/14

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

EBI3 (Human) Recombinant Protein

  • Catalog # : P4568
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human EBI3 recombinant protein expressed in Escherichia coli.
  • Sequence:
  • MRKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK
  • Host:
  • Escherichia coli
  • Theoretical MW (kDa):
  • 23.4
  • Form:
  • Lyophilized
  • Preparation Method:
  • Escherichia coli expression system
  • Purity:
  • ≥ 90%
  • Endotoxin Level:
  • ≤ 5 EUs/?g
  • Quality Control Testing:
  • 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue

    QC Testing of P4568
    Lane 1: non-reducing conditions
    Lane 2: reducing conditions
  • Storage Buffer:
  • Lyophilized from a sterile (0.2 micron) filtered aqueous solution (0.1% Trifluoroacetic Acid (TFA), 0.5% mannitol)
  • Storage Instruction:
  • Store at -20°C.
  • Note:
  • Product Reconstitution: Sterile 10 mM HCl at 0.1 mg/mL
    Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80°C and avoid repeat freeze thaws. Upon reconstitution, a small amount of visible precipitate can be expected. A 10% overfill has been added to the total material vialed to compensate for this loss.
  • Applications
  • SDS-PAGE
  • Application Image
  • SDS-PAGE
  • Gene Information
  • Gene Name:
  • EBI3
  • Gene Alias:
  • IL27B
  • Gene Description:
  • Epstein-Barr virus induced 3
  • Gene Summary:
  • This gene was identified by its induced expression in B lymphocytes in response Epstein-Barr virus infection. It encodes a secreted glycoprotein belonging to the hematopoietin receptor family, and heterodimerizes with a 28 kDa protein to form interleukin 27 (IL-27). IL-27 regulates T cell and inflammatory responses, in part by activating the Jak/STAT pathway of CD4+ T cells. [provided by RefSeq
  • Other Designations:
  • Epstein-Barr virus induced gene 3,cytokine receptor,interleukin-27 subunit beta
  • RSS
  • YouTube
  • Linkedin
  • Facebook