Products

Product Description

Human EBI3 recombinant protein expressed in Escherichia coli.

Sequence

MRKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK

Host

Escherichia coli

Theoretical MW (kDa)

23.4 (Monomer)

Form

Lyophilized

Preparation Method

Escherichia coli expression system

Purity

>= 90% (by Reducing and Non-Reducing SDS PAGE)

Endotoxin Level

<= 5 EUs/ug (by Kinetic LAL)

Quality Control Testing

1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue

Lane 1: non-reducing conditions
Lane 2: reducing conditions

Storage Buffer

Lyophilized from a sterile (0.2 micron) filtered aqueous solution (0.1% Trifluoroacetic Acid (TFA), 0.5% mannitol)

Storage Instruction

Store at -20°C.

Note

Product Reconstitution: Sterile 10 mM HCl at 0.1 mg/mL
Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80°C and avoid repeat freeze thaws. Upon reconstitution, a small amount of visible precipitate can be expected. A 10% overfill has been added to the total material vialed to compensate for this loss.